<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1813 1813-30927 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151QKLM, T215F K219EQ     T69TN, K102Q, K103R, V118I, K122E, D123E, I202V, H208HY, F214L  
>1813-30927| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQRKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKVEELRQYLLRWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84IV, L90M F53FL L10I, E35D, M36I, K43KE, D60E, I62V, L63P, A71V L89LP
>1813-30927| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWEPKMIGGIGGLVKVRQYEQVP
IEICGHKVIGTVLVGPTPANVIGRNPMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006