<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1862 1862-30925 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR       V118I, K122E, I135T, S162C, Q174L, V179I, G196E, Q207H, R211K, F214L, L228R  
>1862-30925| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKLNPDIIIYQYMDDLYVGSDLEIEQHRTKIEELRHHLLKWGLTTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54IV N88D T12S, I13IV, L19I, K20KT, E35ED, N37NS, R41RK, L63P, I66IF, K70R, A71V, T74TS, V77I  
>1862-30925| codons 4-99
TLWQRPLVSVKIGGQITEALLDTGADNTVLEDMSLPGKWKPKMIGGIGGFVKVRQYDQIP
IEFCGHRVIGSVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006