<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1855 1855-30924 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82VA, L90LM   I15IV, K20I, M36I, K43KR, R57K, I62V, L63P, A71IV, I72T, T74S, I85IV, I93L  
>1855-30924| codons 4-99
TLWQRPLVTIKVGGQLIEALLDTGADDTVLEEINLPGRWRPKIIGGIGGFVKVKQYDQVP
IEICGHKVTGSVLVGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006