<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1827 1827-30929 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V K219N Y181C   E44D, R83K, A98S, K122P, D123E, D177E, V179VI, G196E, I244IM, V245I  
>1827-30929| codons 38-247
CTEMEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDPEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIICQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTP
DNKHQKEPPFLWMGYELHPDKWTVQPMILP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10I, K45KR, L63LP, I64V, V77VI, I93L  
>1827-30929| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYDQIP
VEICGHKAIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006