<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1843 1843-30930 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I47IV, I54IM, V82IM, L90LM   L10I, I13IV, K20I, N37T, Q61K, L63Q, I64V, V77I  
>1843-30930| codons 4-99
TLWQRPIVTVKIGGQLIEALLDTGADDTVLEEMTLPGRWKPKIVGGIGGFMKVRQYDKIQ
VEICGHKAIGTVLIGPTPMNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       T39TK, K122E, D123N, I135T, S162SR, I178IM, T200A, Q207A, R211K F160FI
>1843-30930| codons 38-247
CKELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIIQRSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRAKIEELRAHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006