<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1845 1845-30930 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A, L90M G73T L10I, K20I, K43KR, L63P, I64V, A71I, V77I, I93L  
>1845-30930| codons 4-99
TLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWRPKLIGGIGGFVKVRQYDQIP
VEICGHKIITTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, M184MV, L210W, T215Y K219N K103KN, Y181YC, Y188Y*FL   T39AE, E44D, A98AS, V118I, K122E, D177E, I178M, V189VI, G196E, T200TI, Q207E, R211K  
>1845-30930| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVICQYVDDLLIGSDLEIEQHRIKIEELREHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006