<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1828 1828-30929 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q Y188L   T39TS, V60VI, T69TN, L109I, K122P, I142IV, D177E, V179I, I202IV, R211K, D218E, V245R  
>1828-30929| codons 38-247
CSEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVIDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYMDDLLVGSDLEIGQHRTKVEELRQHLLKWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIRLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, E35D, M36I, N37E, R57RK, L63P, K70R  
>1828-30929| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVKQYDQIP
IEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006