<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1818 1818-30924 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54L, L76V   L10I, I13V, L19V, K20IT, E35D, M36I, D60E, I62V, L63P, I64V, A71AT, V82VI  
>1818-30924| codons 4-99
TLWQRPIVTVKIGGQVTEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFLKVRQYEQVP
VEICGHKTIGTVVVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V118I, K122E, I135V, D177E, I178V, T200A, V245T  
>1818-30924| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEVVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006