<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1817 1817-30924 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, I84V, L90M Q58E, G73S, L89V L10I, I13IV, I15V, L19V, K20M, M36L, L38W, I62V, L63P, A71V, I72IM  
>1817-30924| codons 4-99
TLWQRPIVTVKVGGQVMEALLDTGADDTVLEELNWPGRWKPKMIGGIGGFVKVREYDQVP
IEICGHKVMSTVLVGPTPFNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W T215D Y181C, G190A A98G, K101N T39A, K43Q, E44D, V106VI, V118I, K122E, I135T, Q174K, E203EK, Q207E, H208Y, R211K  
>1817-30924| codons 38-247
CAELEQDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLNKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIVICQYMDDLYVASDLEIGQHRTKIKELREYLWKWGFDTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006