<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1807 1807-30923 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67G, K219E   V179D V60I, S68G, D123E, I135T, F214L, V241I  
>1807-30923| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTP
DEKHQKEPPFLWMGYELHPDKWTIQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, I84V, L90M V11I, F53L, Q58QE T12S, L19I, K20I, L33V, L63P, A71I  
>1807-30923| codons 4-99
TLWQRPLISIKIGGQIIEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGLMKVREYDQIP
IEICGHKIIGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006