<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1808 1808-30923 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54A, V82A   L10I, I62V, L63P, A71V, I72V, V77I, I93L  
>1808-30923| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGVGGFAKVRQYDQVP
IEICGHKVVGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F K219Q Y181C A98G K64H, T69N, K122E, T139M, I142V, S162A, G196E, I202V, D218E, L228H, D237DN  
>1808-30923| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTP
EQKHQKEPPFHWMGYELHPNKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006