<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1823 1823-30924 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, L210W, T215Y   G190A   E44D, K102R, V118I, K122E, D123E, I142V, K173E, G196E, T200A, E203A, Q207E, R211K, V245R  
>1823-30924| codons 38-247
CTEMEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFREQNPDIVIYQYMDDLYVASDLEIEQHRAKIAELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIRLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I50V, I54ST, V82A, L90M   L10I, E34Q, R41K, I62V, L63P, A71L, I72V, V77I, I93L  
>1823-30924| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGKWKPKIIVGVGGFTKVRQYDQVP
IEICGHKLVGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006