<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1821 1821-30924 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, I13V, K14R, I15V, K20M, E35D, M36V, N37NS, I62V, L63P, A71V, I93L  
>1821-30924| codons 4-99
TLWQRPIVTVRVGGQLMEALLDTGADDTVLEDVSLPGRWKPKMIGGIGGFIKVRQYDQVP
IEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   Y181C   T39A, K64KR, K122E, D123E, I135T, T200A, Q207E, R211K, K223Q, L228R, Q242L  
>1821-30924| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTP
DKKHQQEPPFRWMGYELHPDKWTVLPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006