<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1180 1180-30922 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M F53L L10I, I15V, K20I, E35N, M36I, R41K, R57K, Q61N, L63P, I72IV, T74S, V82I, I85V, L89LI  
>1180-30922| codons 4-99
TLWQRPIVTIKVGGQLIEALLDTGADDTILENINLPGKWKPKIVGGIGGLMKVKQYDNIP
IEICGHKAVGSVLVGPTPINIVGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184MV, T215F V75I K103N   T39TA, V60I, V90I, K101R, K122E, D123E, I132L, I135V, E138G, S162C, H221Y, L228LHIN, I244V  
>1180-30922| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKIIDFRELNKRTQDFWEIQLGIPHP
AGLRKNKSVTVLDVGDAYFSVPLDEEFRKYTAFTLPSVNNGTPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTP
DKKYQKEPPFNWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006