<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1178 1178-30909 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82S L24I, L33F L10I, T12P, K14R, N37D, I62V, L63P, G68E, A71I, I72V, V77I, I93L  
>1178-30909| codons 4-99
TLWQRPIVPIRIGGQLKEALIDTGADDTVFEEMDLPGRWKPKLIVGIGGFVKVRQYDQVP
IEICEHKIVGTVLIGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q   Y181YF T39TA, K46KE, V60I, V118I, K122E, D123N, I135T, E138A, G196E, I202V, F214L L109LP, F116FL
>1178-30909| codons 38-247
CAEMEKEGEISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVPDVGDAYLSIPLDENFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIFQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006