<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1176 1176-30901 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82S   L10IV, T12TN, I15IV, L19I, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L63C, I72V, T74S, I93L  
>1176-30901| codons 4-99
TLWQRPVVNIKVGGQIREALLDTGADDTVLEDINLPGKWKPKLIVGIGGFVKVKQYDNVC
IEICGHKAVGSVLVGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, Q151M, M184V, L210W, T215Y F77L K101E, G190A V108I T39A, I94L, K122E, D123DN, I135L, G196K, E203D, Q207E, R211RK, H221Y  
>1176-30901| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLMDLRELNKRTQDFWEVQLGLPHP
AGLEKKKSVTILDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIKQHRTKIDELREHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006