<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1055 1055-30707 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82F, L90M F53FL L10I, K20I, E35D, M36V, R41K, R57K, Q61N, I62IV, L63Q, I64IV, A71V, T74S, I93L  
>1055-30707| codons 4-99
TLWQRPIVTIKIGGQLIEALLDTGADDTVLEDVNLPGKWKPKIVGGIGGLVKVKQYDNVQ
VEICGHKVIGSVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q K101E, Y181C, G190A   V60I, K122E, I135V, Q174QK, D177N, T200A, F214L, L228H  
>1055-30707| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPNIVICQYMDDLYVASDLEIGQHRAKIEELRQHLLRWGLFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006