<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1054 1054-30701 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75IL, F77FL, F116Y K103KN, G190A P225H K49R, E53D, K102Q, K104R, K122E, D123E, E169D, P170PL, D177E, I202V  
>1054-30701| codons 38-247
CTEMEKEGKISRIGPDNPYNTPVFVIKKKDSTKWRKLLDLRELNKRTQDFWEVQLGIPHP
AGLKQNRSVTVLDVGDAFYSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILDLFRKQNPEIVIYQYVDDLYVASDLEIGQHRTKVEELRQHLLRWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, L76V, L90M L89V L10I, I15V, K20T, E35G, M36I, N37D, I62V, L63P, H69K, A71AV, V77I, V82I, I85V  
>1054-30701| codons 5-99
LWQRPIVTIKVGGQLTEALLDTGADDTVLEGIDLPGRWKPKIIGGIGGFVKVRQYDQVPI
EICGKKVIGTVVIGPTPINIVGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006