<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1157 1157-30918 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A N88D L10I, I15V, K20R, E35D, M36I, R41K, K43KR, K45R, R57K, Q61D, L63P, A71T, I93L  
>1157-30918| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWRPRMIGGIGGFVKVKQYDDIP
IEICGHKTIGTVLVGPTPANIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       T39TA, V60I, S162SN, T200I, R211RK, K223KR  
>1157-30918| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGFYTP
DKKHQREPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006