<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1130 1130-30915 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S L33F, K43T L10I, N37D, I62V, L63P, A71T, I72E, V77I, I93L  
>1130-30915| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMDLPGRWTPKMIVGIGGFVKVRQYDQVP
IEICGHKTEGTVLIGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       T39A, K102E, D123E, I142T, I178IM, V179VIM, V189VI, Q207E, R211K, L228H, D237DN  
>1130-30915| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKEKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMMIYQYMDDLYIGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFHWMGYELHPNKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006