<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1122 1122-30729 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82A   L10I, K20KR, E35D, M36I, N37D, R57K, I62V, L63P, C67CS, A71T, I72IT  
>1122-30729| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVKQYDQVP
IEISGHKTTGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215F K219Q G190Q A98G, V179D V118I, K122E, I135T, Q197L, R211S, F214L, V245E D113DY, R143RG
>1122-30729| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGYAYFSIPLDEDFRKYTAFTIPSTNNETPGIGYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDIYQYMDDLYVQSDLEIGLHRTKIEELRQHLLSWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006