<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1101 1101-30630 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10I, L19I, K20I, E35D, M36I, P39Q, L63P, I64V, I72V, V77VI  
>1101-30630| codons 4-99
TLWQRPIVTIKIGGQIIEALLDTGADDTVLEDINLQGRWKPKIIGGIGGFIKVRQYDQIP
VEICGHKAVTTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74V, L210W T215ACGS L100I, K103N   D121H, K122E, I135T, I142V, T165I, Q174QH, I202V, E203Q, Q207DH, H208HY, R211K  
>1101-30630| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKHNPDIVIYQYMDDLYVGSDLEIGQHRTKVQELRHYLWKWGFSTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006