<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1026 1026-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82C, I84V L24I, Q58E, T74P L10I, I15V, L19T, K55R, L63P, A71AV, I72IR, V77I  
>1026-30623| codons 4-99
TLWQRPIVTIKVGGQTKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVREYDQIP
IEICGHKVRGPVLIGPTPCNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q K103KNRS   V60I, T69TN, I135T, R172RK, I195T, G196GE, Q197P, T200A, F214L  
>1026-30623| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLETEPHRAKIEELRQHLLRWGLVTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006