<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1025 1025-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, T215F D67G, K219Q K101E, Y181C V108I K64R, A98S, D123E, I135V, I142V, K166R, D177E, I178L, Q207E, L228R  
>1025-30623| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIRKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLEKKKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPELVICQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFFTP
DQKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, I54IL N88ND K14NS, I15V, L19I, K20T, E35D, M36MI, D60E, L63P, A71IV  
>1025-30623| codons 4-99
TLWQRPLVTISVGGQITEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFLKVRQYEQIP
IEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006