<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1107 1107-30626 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10V, I15V, G16E, K20R, E35D, M36I, P39T, R41K, R57K, Q61N, L63T  
>1107-30626| codons 4-99
TLWQRPVVTIKVEGQLREALLDTGADDTVLEDINLTGKWKPKMIGGIGGFVKVKQYDNIT
IEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215FY K219E     K49KR, V60I, K64KR, K65KE, K102Q, I135V, S162C, R211K P157PL
>1107-30626| codons 38-247
CTELEKEGKISRIGPENPYNTPIFAIREKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSL
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006