<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1106 1106-30625 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN   K14R, I15IV, G17E, K20KR, E35D, M36I, R41K, R57K, Q61N, L63C, E65ED, A71AV, V75VI, I93IL  
>1106-30625| codons 4-99
TLWQRPLVTIRVGEQLREALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIC
IDICGHKVIGTILVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV       K49R, K122KE, I135L, T165I, N175NH, T200TA, R211K  
>1106-30625| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQHPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006