<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1039 1039-30619 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M F53L, G73S I15V, L19I, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L63P, H69Y, A71V, T74TS, I85IV  
>1039-30619| codons 4-99
TLWQRPLVTIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGLVKVKQYDNVP
IEICGYKVISSVLVGPTPTNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q K101E, Y181C, G190A   K49R, V60I, K66R, I135T, S162A, H208Y, R211K, D218E, L228HR  
>1039-30619| codons 38-247
CTELEKEGKISRIGPENPYNTPIFAIKKRNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQYLLKWGFFTP
EQKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006