<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1037 1037-30619 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181C   E44D, K101Q, K122E, I135T, D177E, I178L, Q207K, R211A, L228R, V245M  
>1037-30619| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELVICQYMDDLYVGSDLEIGQHRTKIEELRKHLLAWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A, L90M   L10I, I15V, K20R, E35D, M36I, N37E, R41K, K55R, R57K, Q61D, L63P, A71V, I72K, I93L  
>1037-30619| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIELPGKWKPKLIGGIGGFVRVKQYDDIP
IEICGHKVKGTVVVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006