<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1035 1035-30618 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82A   L10I, L19I, E35D, N37S, L63P, H69R, A71V  
>1035-30618| codons 4-99
TLWQRPIVTIKIGGQIKEALLDTGADDTVLEDMSLPGRWKPKIIVGIGGFTKVRQYDQIP
IEICGRKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, V75T, M184MV A62V K101KPQT, K103N   K49KR, D123E, D177E, I202V S68SDGN, Q242Q*
>1035-30618| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFVIKRKDNTKWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLTKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTV*PIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006