<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1028 1028-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76V, I84V, L90M L33F L10I, I13V, G16A, K20T, N37E, K55R, I62IV, L63P, I66IV, A71V, I93L  
>1028-30623| codons 4-99
TLWQRPIVTVKIAGQLTEALLDTGADDTVFEEMELPGRWKPKIIGGIGGFLRVRQYDQVP
IEVCGHKVIGTVVVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74LV, M184V, L210LW, T215Y   K103N   R83K, A98S, V118VI, K122KE, D123E, I135T, S162Y, G196GE, R211RK  
>1028-30623| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006