<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1197 1197-30924 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IM, V82A, L90M L10F, K43KT, G73GS I15V, L19Q, K20I, L63P, A71V, I72L, V77I, I93L  
>1197-30924| codons 4-99
TLWQRPFVTIKVGGQQIEALLDTGADDTVLEEMNLPGRWTPKIIGGIGGFMKVRQYDQIP
IEICGHKVLSTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, Y115F, Q151M, M184MV A62V, D67DG, V75I, F77L, F116Y K103N, Y181C, G190A   K46Q, T58N, S68SR, R83RK, V111I, K122E, D123E, I135T, S162C, R211RIM, F214L  
>1197-30924| codons 38-247
CTEMEKEGQISKIGPENPYNNPVFVIKRKGRTKWRKLIDLRELNKKTQDFWEVQLGIPHP
AGLKKNKSVTVLDIGDAFYSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQHLLMWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006