<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1196 1196-30924 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53L L10I, K20R, E35D, M36I, N37ND, R41K, D60E, Q61N, L63P, H69R, A71V, I85V  
>1196-30924| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGLVKVRQYENIP
IEICGRKVIGTVLVGPTPANIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215F K219Q L100I, K103N V108I V60I, I135V, D218E, V245S  
>1196-30924| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPISLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006