<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1115 1115-30716 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50IV, I54IM, V82A, L90M L23I, L33F, K43T, F53FL T4S, L10I, L63P, H69Q, A71V, I85IV, I93L  
>1115-30716| codons 4-99
SLWQRPIVTIKIGGQLKEAILDTGADDTVFEEMNLPGRWTPKIIGGVGGLMKVRQYDQIP
IEICGQKVIGTVLVGPTPANIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N P225H K122E, V189I, R211RK, L228LI, V245M  
>1115-30716| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYIGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEHPFIWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006