<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1111 1111-30630 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82C, I84V, L90M L10F, L33F, G73C N37S, R41K, K55R, R57K, I62V, L63P, I64V, I66FL, C67Y, A71T, I72T, I93L  
>1111-30630| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVFEEMSLPGKWKPKIIGGIGGFVRVKQYDQVP
VELYGHKTTCTVLVGPTPCNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65KR, D67N, K70KR, Q151M, T215F A62V, V75I, F116Y, K219Q Y181V   G112GA, K122E, S162A, P170L, D177E, T200TI, I202IV, R211RS, D218E, L228H  
>1111-30630| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKRKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVADAYYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQASMTKILELFRKQNPEIVIVQYMDDLYVGSDLEIGQHRIKVEELRQHLLSWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006