<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1112 1112-30630 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, M184V   Y181C   K122E, I135T, S162C, F214L, H221Y, L228R  
>1112-30630| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
DKKYQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I84IV L33F, F53FL L10I, K14KR, G17GE, K55KR, Q61E, I62V, L63P, H69Y, V77I, I93L  
>1112-30630| codons 4-99
TLWQRPIVTIRIGEQLKEALLDTGADDTIFEEMNLPGRWKPKIVGGIGGLIRVRQYDEVP
IEICGYKAIGTVLIGPTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006