<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1050 1050-30625 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215Y K219Q Y181C   T39A, E44ED, V60I, V118I, K122AP, D177E, V179VA, T200A, H208Y, R211K, F214L, D218E, L228H  
>1050-30625| codons 38-247
CAELEKDGKISKIGPENPYNTPIFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIAICQYMDDLYVGSDLEIGQHRAKIEELRQYLLKWGLYTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M V11I, Q58E, G73GS, L89V L10I, I13V, K14R, K20I, N37N_N, R41K, K55KR, D60E, L63P, I64IV, A71I, I72M, V77I, I93L M36E
>1050-30625| codons 4-99
TLWQRPIITVRIGGQLIEALLDTGADDTILEEENLPGKWKPKIVGGIGGFMRVREYEQIP
VEICGHKIMSTVLIGPTPVNIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006