<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1048 1048-30625 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N V108I K43N, V60I, K102KR, V118VI, I135T, S162SC, T200TA, E203EK, R211K, K223E, L228R, I244IV, V245VE  
>1048-30625| codons 38-247
CTELENEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIKELRQHLWKWGFYTP
DKKHQEEPPFRWMGYELHPDKWTVQPVELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53FL, G73S L10V, I15V, L19I, N37ND, K55KR, R57RK, D60E, I62V, L63P, A71V, I72IL  
>1048-30625| codons 4-99
TLWQRPVVTIKVGGQIKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGLVRVKQYEQVP
IEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006