<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1047 1047-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215F D67H, K219Q   P225H E44EA, V60I, W88S, V90I, D123E, I135T, S162Y, D177E, T200A, E203D, R211KT L187LS
>1047-30623| codons 38-247
CTELEKAGKISKIGPENPYNTPIFAIKKKHSTRWRKLVDFRELNKRTQDFSEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIVIYQYMDDSYVGSDLEIGQHRAKIDELRQHLLTWGFFTP
DQKHQKEHPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73GS K14KR, L63P, A71V, I72L, V77VI, I93L  
>1047-30623| codons 4-99
TLWQRPFVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVLSTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006