<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1042 1042-30617 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_SS, T215Y   K101E, K103N, G190A   K64KR, D121Y, K122E, E138A, I142T, D192N, T200A, R211A Q222H
>1042-30617| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKNKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNATPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVASNLEIGQHRAKIEELRQHLLAWGFYTP
DKKHHKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, K43KT, Q58QE, G73S K14R, K20I, E35G, M36I, N37D, R57K, D60E, Q61E, I62V, L63P, I66F, H69Y, A71T, I72T, I93L  
>1042-30617| codons 4-99
TLWQRPFVTIRIGGQLIEALLDTGADDTVLEGIDLPGRWTPKIIGGIGGFVKVKEYEEVP
IEFCGYKTTSTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006