<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1194 1194-30929 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54IV, I84IV, L90M   L10I, I13V, Q18H, K20T, E35D, N37PT, R41RK, Q61QHKN, I64V, I66IF, A71AV, V77VI, Q92QK  
>1194-30929| codons 4-99
TLWQRPIVTVKIGGHLTEALLDTGADDTVLEDMTLPGKWKPKLIGGIGGFVKVRQYDNIL
VEFCGHKVIGTVLIGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR Y188L   K43Q, E44D, K101Q, V118I, K122E, I178IM, G196E, H208Y, R211K, E224D, V245E  
>1194-30929| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLLVGSDLEIEQHRTKIEELRQYLWKWGFYTP
DRKHQKDPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006