<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1187 1187-30918 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54AV, V82A, L90M F53L L10I, T12S, I15IV, N37E, K55R, I62IV, L63P, A71I, V77I, I93L  
>1187-30918| codons 4-99
TLWQRPIVSIKVGGQLKEALLDTGADDTVLEEMELPGRWKPKLIVGIGGLVRVRQYDQVP
IEICGHKIIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T215CNSY K219KE Y181YC, G190A   K49KR, D123E, I135T, I142IT, D177E Y232H
>1187-30918| codons 38-247
CTELEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTP
DEKHQKEPPFLWMGHELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006