<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1172 1172-30915 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M F53FL, G73GS L10I, L19V, K20R, M36I, N37ND, R41K, R57RK, I62V, L63P, I64IM, A71V, I72T, I85V, I93L  
>1172-30915| codons 4-99
TLWQRPIVTIKIGGQVREALLDTGADDTVLEEIDLPGKWKPKIIGGIGGLVKVKQYDQVP
MEICGHKVTSTVLVGPTPTNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215HY A62V   A98G T39A, E44D, S68SG, K122E, D123N, I135T, T165I, Q174K, G196E, T200TA, I202IV, R211Q  
>1172-30915| codons 38-247
CAELEKDGKISKIGPENPYNTPVFVIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKKNPDIVIYQYVDDLYVGSDLEIEQHRAKVEELRQHLWQWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006