<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1168 1168-30911 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V F53L L10V, T12E, I15V, K20R, E35D, M36I, R41K, K45R, R57K, Q61N, A71V, T74S, I85V, L89I  
>1168-30911| codons 4-99
TLWQRPVVEIKVGGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGLVKVKQYDNIL
IEICGHKVIGSVLVGPTPANVVGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N K103N, Y181C V179VF E44D, E53D, V118I, K122KE, I135L, I142V, A158AS, S162Y, E194ED, R211K, F214FC, L228LR K220KE
>1168-30911| codons 38-247
CTELEKDGKISKIGPDNPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSP
SIFQYSMTKILEPFRKQNPDIFICQYMDDLYVGSDLDIGQHRTKIEELRQHLWKWGCYTP
DNEHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006