<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1169 1169-30910 Argentina 2003 HIV1 U Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C V108VI K43R, S134SG, I142V, V179I, H221Y L193L*
>1169-30910| codons 38-247
CTEMEREGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSVPLDKDFRKYTAFTIPGINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVGSD*EIGQHRTKIEELRQHLLRWGFTTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47A, L90M   I15V, K20R, E35D, M36I, N37D, R41K, R57K, V77I, V82I Q61Y
>1169-30910| codons 4-99
TLWQRPLVTIKVGGQLREALLDTGADDTILEDIDLPGKWKPKLAGGIGGFIKVKQYDYIL
IEICGHKAIGTVLIGPTPINIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006