<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1163 1163-30903 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E Y181C, G190A   V60VI, K122E, T139TI, E203ED, Q207E, L228H, I244IM  
>1163-30903| codons 38-246
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNEIPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKIDELREHLWRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPMVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10IV, I15IV, K20R, E35D, M36I, N37D, R41K, R57K, Q61N, I62IV, L63P, I64V, T74S, V77I, I93L  
>1163-30903| codons 4-99
TLWQRPVVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVKQYDNVP
VEICGHKAIGSVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006