<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1088 1088-30820 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   L100I, K103N   E44D, A98S, D123E, I135T, Q174K, D177E, Q207E, R211K, D237E, V245M  
>1088-30820| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
SGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPEKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, L90M   T12E, I15V, L19I, R57K, L63P, A71V, T74S  
>1088-30820| codons 4-99
TLWQRPLVEIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVKQYDQIP
IEICGHKVIGSVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006