<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1099 1099-30730 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A, L90M G73S Q7QK, L10I, I13IMV, I15V, L19LQ, K20I, M36I, N37ND, Q61N, I62V, L63P, C67F, A71V, I72L  
>1099-30730| codons 4-99
TLWKRPIVTVKVGGQQIEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVKVRQYDNVP
IEIFGHKVLSTVVVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219R L100I, Y188L   E44D, K122E, D123T, D177E, T200E, H208Y, R211K, D218E, V245K  
>1099-30730| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKKKSVTVLDVGDAYFSVPLDETFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLLVGSDLEIGQHREKIEELRQYLWKWGFYTP
ERKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006