<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1097 1097-30730 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48MV, I54T, V82S L33F L10I, I15V, G16A, K20M, M36I, I62IV, L63P, A71V, L89LI  
>1097-30730| codons 4-99
TLWQRPIVTIKVAGQLMEALLDTGADDTVFEEINLPGRWKPKMIVGIGGFTKVRQYDQVP
IEICGHKVIGTVLVGPTPSNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75A, K219E     E44D, K102Q, V118I, K122E, I135T, T200I, R211K, V245K  
>1097-30730| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLADFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRIKIEELRQHLWKWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006