<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1089 1089-30716 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L90M   T12N, I15V, G16GE, K20RT, E35D, M36V, P39S, R41K, R57K, Q61N, I62V, L63V, A71I, I72T, V77VI, I93L  
>1089-30716| codons 4-99
TLWQRPLVNIKVEGQLTEALLDTGADDTVLEDVNLSGKWKPKLIGGIGGFVKVKQYDNVV
IEICGHKITGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, Y181YC, G190S   T39TA, K49R, V60I, T69TN, V90VI, D123E, I135V, V179VI, G196K, Q197K, T200I, R211K  
>1089-30716| codons 38-247
CAEMEKEGKISRIGPENPYNTPIFAIKKKDSNKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYMDDLYVSSDLEIKKHRIKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006