<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1087 1087-30715 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10V, K20R, E35D, M36I, N37D, R41K, R57K, Q61N, I62IV, L63P, A71V, T74S, I93L  
>1087-30715| codons 4-99
TLWQRPVVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVKQYDNVP
IEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215Y K219E K103N, Y181C V108VI, K238T T39A, K122E, D123DN, I135L, D177E, I178M, R211G, D218E, L228R  
>1087-30715| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFYTP
EEKHQKEPPFRWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006